Protein coding transcript 52189

• Transcript: Ll_transcript_507909
• CDS coordinates: 296-604 (+)
• Peptide sequence: MSVFQARAIRHAQTCISRCSYTLHSCHSHTPRYMSKLAPLQERKMRDRVKIFAKAGDGGGGCISFRRSQRDRHGRPDGTVSTLYIVYLYSYAGYYMKRHLFY*
• ORF Type: complete

Annotations of Ll_transcript_507909

• Blastp: Probable GTP-binding protein OBGM, mitochondrial from Oryza sativa with 64.29% of identity
• Blastx: Probable GTP-binding protein OBGM, mitochondrial from Arabidopsis with 36.73% of identity
• Eggnog: An essential GTPase which binds GTP, GDP and possibly (p)ppGpp with moderate affinity, with high nucleotide exchange rates and a fairly low GTP hydrolysis rate (By similarity). It may play a role in control of the cell cycle, stress response, ribosome biogenesis and in those bacteria that undergo differentiation, in morphogenesis control(COG0536)
• Kegg: Link to kegg annotations (4351211)
• CantataDB: Link to cantataDB annotations (CNT0002738)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453178.1)
• Pfam: GTP1/OBG (PF01018.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;