Protein coding transcript 52190

• Transcript: Ll_transcript_507935
• CDS coordinates: 1085-1939 (+)
• Peptide sequence: MDDTLKFGTEDIGEEQEIQYSVAELTEEGQQIIIARGGEGGLGNVSMSKDLRKSMATKVGAYQDRPDLDDSDSDYSSLSGGVPGSETVLILELKSIADVSFVGMPNAGKSTLLGAISRAKPAVGHYAFTTLRPNLGNLNYDDFSITVADIPGLIKGAHENRGLGHAFLRHIERTKVLAYVVDLAAALDGRKGIPPWEQLKDLILELEYHQDGLSNRPSLIVANKIDEEGAEEVYKELQRRVQGATIFPVCAVLGDGIPELKAGLRLLVNSEMSSTLSLDQIFID*
• ORF Type: complete

Annotations of Ll_transcript_507935

• Blastp: Probable GTP-binding protein OBGM, mitochondrial from Arabidopsis with 68.25% of identity
• Blastx: Probable GTP-binding protein OBGM, mitochondrial from Arabidopsis with 52.9% of identity
• Eggnog: An essential GTPase which binds GTP, GDP and possibly (p)ppGpp with moderate affinity, with high nucleotide exchange rates and a fairly low GTP hydrolysis rate (By similarity). It may play a role in control of the cell cycle, stress response, ribosome biogenesis and in those bacteria that undergo differentiation, in morphogenesis control(COG0536)
• Kegg: Link to kegg annotations (AT1G07615)
• CantataDB: Link to cantataDB annotations (CNT0002738)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453178.1)
• Pfam: 50S ribosome-binding GTPase (PF01926.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;