Protein coding transcript 52260

• Transcript: Ll_transcript_304368
• CDS coordinates: 1-654 (+)
• Peptide sequence: NTGEGVRQSEYASIIGSLRYATDCTRPDIAYVVGLLCRLTSRPSMEHLNAIERVMRYLKKTMNLGLHYRRFPAVLEGYSDADWNTLSDDSKATSGYIFSIAGGAVSWKSKKQTILAQSTIEAEMIALATASEEASWLRSLLAEIPLWKKQISVVLIHCDSTAAIAKIENRFYNGKKRQIRRKYNIIRECLSIRAVRVDHVRGENNLAEPLTKGLARKK
• ORF Type: internal

Annotations of Ll_transcript_304368

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 38.46% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 38.46% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006575788.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;