Protein coding transcript 5231

• Transcript: Ll_transcript_351716
• CDS coordinates: 178-1260 (+)
• Peptide sequence: MNHISLLLLSLSLLFVSVFSSDGADPLIRQVIDGGDARLGAEDHFSAFKTRFGKTYSSRGEHDYRFKVFKANLRRAQRHQNMDPSATHGVTRFSDLTPSEFRDSVLGLRRLRLPSDANKAPILPTDNLPNDFDWRDHGAVTPVKNQGSCGSCWSFSTNGALEGAHFLSTGELVSLSEQQLVDCDHECDPDEPGSCDAGCNGGLMNSAFEYILKSGGVMREEDYPYSGTDRGTCKFDKKKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVFMQTYIGGVSCPYICSKHLDHGVLLVGYGSDAYAPIRMKEKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHTSTT*
• ORF Type: complete

Annotations of Ll_transcript_351716

• Blastp: Cysteine protease RD19A from Arabidopsis with 76.83% of identity
• Blastx: Cysteine protease RD19A from Arabidopsis with 77.37% of identity
• Eggnog: cathepsin(COG4870)
• Kegg: Link to kegg annotations (AT4G39090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454205.1)
• Pfam: Cathepsin propeptide inhibitor domain (I29) (PF08246.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;