Protein coding transcript 52357

• Transcript: Ll_transcript_301860
• CDS coordinates: 860-1264 (+)
• Peptide sequence: MASQPDINMKMRSILVDWLIEVHRKFELMPETLYLTLNIIDRFLSMKAVPRRELQLVGISSMLIACKYEEIWAPEVNDFVYIADHAYVREHILIMEKTILSKLEWYLTVPTPYVFLVRYIKASTPSDKEVILLL*
• ORF Type: complete

Annotations of Ll_transcript_301860

• Blastp: Cyclin-B1-2 from Arabidopsis with 40.7% of identity
• Blastx: G2/mitotic-specific cyclin S13-6 from Soja with 60.18% of identity
• Eggnog: g2 mitotic-specific(COG5024)
• Kegg: Link to kegg annotations (AT5G06150)
• CantataDB: Link to cantataDB annotations (CNT0000929)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434553.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;