Transcript | Ll_transcript_301867 |
---|---|
CDS coordinates | 860-1579 (+) |
Peptide sequence | MASQPDINMKMRSILVDWLIEVHRKFELMPETLYLTLNIIDRFLSMKAVPRRELQLVGISSMLIACKYEEIWAPEVNDFVYIADHAYVREHILIMEKTILSKLEWYLTVPTPYVFLVRYIKASTPSDKEIENMVFFLAELSLMDYSIVINYCPSLIAASAVYAARCTLGRSPYWTETLRHYTGYSEEQLRGCSKIMANFHSAAPESKLRAVYKKFSSSERSAVALVDPAKYLLAPSPQS* |
ORF Type | complete |
Blastp | Cyclin-B1-2 from Arabidopsis with 40.7% of identity |
---|---|
Blastx | G2/mitotic-specific cyclin S13-6 from Soja with 57.45% of identity |
Eggnog | g2 mitotic-specific(COG5024) |
Kegg | Link to kegg annotations (AT5G06150) |
CantataDB | Link to cantataDB annotations (CNT0000929) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434553.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer