Protein coding transcript 52609

• Transcript: Ll_transcript_302162
• CDS coordinates: 1421-2083 (+)
• Peptide sequence: MEVVASWTKALCIDISQGRIPNHVEDVKAVPSELDDNLLSCWSVLDIGTGNGLLLQELAKQGFSDLTGTDYSEQAISLAQSLANRDGFPNIKFLVDDVLETTLEQEFQLVMDKGTLDAIGLHPDGPAKRMLYWDSVSKLVAPGGILVITSCNNTKDELVQEVENFNQRKLAASLELVAAKNEESCSDNVFQYVNHVRTYPTFTFGGSVGSRVATVAFRQK*
• ORF Type: complete

Annotations of Ll_transcript_302162

• Blastp: EEF1A lysine methyltransferase 2 from Homo with 51.24% of identity
• Blastx: EEF1A lysine methyltransferase 2 from Homo with 51.24% of identity
• Eggnog: Methyltransferase,-like protein(ENOG4111PXE)
• Kegg: Link to kegg annotations (399818)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419247.1)
• Pfam: Ribosomal protein L11 methyltransferase (PrmA) (PF06325.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;