Transcript | Ll_transcript_302151 |
---|---|
CDS coordinates | 1421-1888 (+) |
Peptide sequence | MEVVASWTKALCIDISQGRIPNHVEDVKAVPSELDDNLLSCWSVLDIGTGNGLLLQELAKQGFSDLTGTDYSEQAISLAQSLANRDGFPNIKFLVDDVLETTLEQEFQLVMDKGTLDAIGLHPDGPAKRMLYWDSVSKLVAPGGILVSTSKFIKT* |
ORF Type | complete |
Blastp | EEF1A lysine methyltransferase 2 from Homo with 49.09% of identity |
---|---|
Blastx | EEF1A lysine methyltransferase 2 from Homo with 49.09% of identity |
Eggnog | Methyltransferase,-like protein(ENOG4111PXE) |
Kegg | Link to kegg annotations (399818) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003624412.1) |
Pfam | Ribosomal protein L11 methyltransferase (PrmA) (PF06325.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer