Protein coding transcript 52720

• Transcript: Ll_transcript_302946
• CDS coordinates: 296-733 (+)
• Peptide sequence: MACVHSAFLCILPCSNHRTRIRIRISNSGISKFTTQQFKQRFTISISKFHHQLVTSTLLPLPSLQINGSKFPIWVCVAVVVLVAAMREVFSRTRRKERPGSVADLVRRGQLRSDRRGMYDFHPDSTMSFLLTHSIYYHYSLYVCL*
• ORF Type: complete

Annotations of Ll_transcript_302946

• Blastp: Protein MULTIPLE CHLOROPLAST DIVISION SITE 1 from Arabidopsis with 82.17% of identity
• Blastx: Protein MULTIPLE CHLOROPLAST DIVISION SITE 1 from Arabidopsis with 83.33% of identity
• Eggnog: NA(ENOG4111JAJ)
• Kegg: Link to kegg annotations (AT1G20830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438132.1)
• Pfam: -
• Rfam: tRNA (RF00005)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;