| Transcript | Ll_transcript_302331 |
|---|---|
| CDS coordinates | 255-614 (+) |
| Peptide sequence | MSLPRLGVGEEGESNVILLVSSPAKESVCLKSLELKEHNYMGLSDCSSVDSSVPSFSDESKSNLNLKATELRLGLPGSQSPERDYDLCLRSSTQFDEKPLFPLHPSSDDHHSPAKIAVLG |
| ORF Type | 3prime_partial |
| Blastp | Auxin-responsive protein IAA9 from Arabidopsis with 55.88% of identity |
|---|---|
| Blastx | Auxin-responsive protein IAA9 from Arabidopsis with 55.88% of identity |
| Eggnog | auxin-responsive protein(ENOG4111VTJ) |
| Kegg | Link to kegg annotations (AT5G65670) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019417388.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer