Protein coding transcript 52759

• Transcript: Ll_transcript_302600
• CDS coordinates: 1075-1464 (+)
• Peptide sequence: MLADKIDGYRKQEKRLISEFKNHFNVEFSTHNEHREDDGIVHWMERGHPRKFGNVLEGEVETCQQIAQQTGVLVDPVYTLAAWETAMLLSSKEAEGGSGVVMLHTGGTLGMFGLAQRYKGYFGKLKKGT*
• ORF Type: complete

Annotations of Ll_transcript_302600

• Blastp: D-cysteine desulfhydrase 2, mitochondrial from Arabidopsis with 57.94% of identity
• Blastx: Putative D-cysteine desulfhydrase 2, mitochondrial from Oryza sativa with 53.33% of identity
• Eggnog: NA(ENOG410ZUTR)
• Kegg: Link to kegg annotations (AT3G26115)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414317.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;