Protein coding transcript 52762

• Transcript: Ll_transcript_302592
• CDS coordinates: 238-669 (+)
• Peptide sequence: MSTIYGNVTYVPRNVYANREDMLKSYAKSVAGNNGSVICFSDIIQASSTSELPSSPNFMQMDVSRSEGNNVRKILIVNEGAGDSVALVGVIRLVEYLSQDHLFGKQRALKLVVDAGTGTTAVGLGVAALCLGLPWEVYAVMLAD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_302592

• Blastp: D-cysteine desulfhydrase 2, mitochondrial from Arabidopsis with 60.42% of identity
• Blastx: D-cysteine desulfhydrase 2, mitochondrial from Arabidopsis with 63.01% of identity
• Eggnog: NA(ENOG410ZUTR)
• Kegg: Link to kegg annotations (AT3G26115)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414317.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;