| Transcript | Ll_transcript_302598 |
|---|---|
| CDS coordinates | 370-705 (+) |
| Peptide sequence | MSTIYGNVTYVPRNVYANREDMLKSYAKSVAGNNGSVICFSDIIQASSTSELPSSPNFVQMDVSRSEGNNVRKILIVNEGAGDSVALLGNEKMKFLKKTTFHIFRNIHLKKP |
| ORF Type | 3prime_partial |
| Blastp | D-cysteine desulfhydrase 2, mitochondrial from Arabidopsis with 51.69% of identity |
|---|---|
| Blastx | D-cysteine desulfhydrase 2, mitochondrial from Arabidopsis with 58.97% of identity |
| Eggnog | NA(ENOG410ZUTR) |
| Kegg | Link to kegg annotations (AT3G26115) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019414317.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer