Protein coding transcript 52770

• Transcript: Ll_transcript_302957
• CDS coordinates: 255-686 (+)
• Peptide sequence: MALHISSSACFTTLLGHSRVNRIRAEGSSSSSYSSSASATLKTVVEEKVNLGGSDLKVSPLGIGAWSWGDTTYWNNFDWNDRKEKDAKKAFDASIDGGVTFFDTAEVYGSGVSAFLIITFFFNSKFTNYFFSSFSARSRSRKF*
• ORF Type: complete

Annotations of Ll_transcript_302957

• Blastp: Uncharacterized oxidoreductase At1g06690, chloroplastic from Arabidopsis with 52.25% of identity
• Blastx: Uncharacterized oxidoreductase At1g06690, chloroplastic from Arabidopsis with 58.82% of identity
• Eggnog: Aldo keto reductase(COG0667)
• Kegg: Link to kegg annotations (AT1G06690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448954.1)
• Pfam: Aldo/keto reductase family (PF00248.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;