Transcript | Ll_transcript_303796 |
---|---|
CDS coordinates | 225-740 (+) |
Peptide sequence | MSAAVAAAAAAATSGYHKSSKRDHREQSSLTPQGVQVCVLPTLNRYENQKRSDWNSFGEYLINHNPPLTLSLCNGAHVLEFLHYLDQFGKTKVHVQTCAYFGNSYPPGPCPCPMKQSWGSLDGIIGRLHAAFEENVGSSKMNPFGVGAVTLYLRKVRDVQAKARGIVYDKR* |
ORF Type | complete |
Blastp | Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6 from Arabidopsis with 66.15% of identity |
---|---|
Blastx | Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6 from Arabidopsis with 64.93% of identity |
Eggnog | Protein of unknown function (DUF640)(ENOG410YB00) |
Kegg | Link to kegg annotations (AT1G07090) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447640.1) |
Pfam | Protein of unknown function (DUF640) (PF04852.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer