Protein coding transcript 52800

• Transcript: Ll_transcript_303797
• CDS coordinates: 43-732 (+)
• Peptide sequence: MSTAAAISGYHNSSNSNHREQLPLTPQGVQVCVPPTLSRYENQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHAETCAYFGNSHPPGPCPCPLKQAWGSLDALIGRLRAAFEENGGSPEINPFGARAVRLYLREVRDGQAKARGIVYEKKKRRKQSHLQEQNGSIMMMENDAPIHDVVSSREVHSLGYGNGGFVHFSNSGGTNPMLAAASYFSS*
• ORF Type: complete

Annotations of Ll_transcript_303797

• Blastp: Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6 from Arabidopsis with 79.41% of identity
• Blastx: Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6 from Arabidopsis with 79.41% of identity
• Eggnog: Protein of unknown function (DUF640)(ENOG410YB00)
• Kegg: Link to kegg annotations (AT1G07090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462819.1)
• Pfam: Protein of unknown function (DUF640) (PF04852.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;