Protein coding transcript 52805

• Transcript: Ll_transcript_302194
• CDS coordinates: 43-429 (+)
• Peptide sequence: MLSIVGMASSLSENIIAEIPSYITVYKDGSIDRPRQAPFVAASVEDPLNKGVSSKDIIISQNPPISARIYLPTPINHHHLPILVYFHGGGFFFESAFSQLYHHYFNQFVSQIPAIVVSVEYRYALILS*
• ORF Type: complete

Annotations of Ll_transcript_302194

• Blastp: 2-hydroxyisoflavanone dehydratase from Glycyrrhiza with 52.21% of identity
• Blastx: 2-hydroxyisoflavanone dehydratase from Glycyrrhiza with 60.48% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422242.1)
• Pfam: Carboxylesterase family (PF00135.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;