Protein coding transcript 52806

• Transcript: Ll_transcript_302197
• CDS coordinates: 529-828 (+)
• Peptide sequence: MALNGGLKISGAIYAQPYFCSSKAVGSEAVIGHEESYVVWDLVYPSAPGGIDNPMINPLGPEAPSLVGLGCSKILVCVASNDVLRDRGVWYHDAVKESGW
• ORF Type: 3prime_partial

Annotations of Ll_transcript_302197

• Blastp: 2-hydroxyisoflavanone dehydratase from Glycyrrhiza with 63.37% of identity
• Blastx: 2-hydroxyisoflavanone dehydratase from Glycyrrhiza with 57.05% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422242.1)
• Pfam: alpha/beta hydrolase fold (PF07859.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;