Protein coding transcript 52808

• Transcript: Ll_transcript_302201
• CDS coordinates: 515-1045 (+)
• Peptide sequence: MNSEPWLTNHADFNRIFIGGDSAGGNIVHNIAIRGGFQALNGGLKISGAIYAQPYFCSSKAVGSEAVIGHEESYVVWDLVYPSAPGGIDNPMINPLGPEAPSLVGLGCSKILVCVASNDVLRDRGVWYHDAVKESGWKGELQLFEQQDEDHVYHIFNPESEHAKILTKLMASFILH*
• ORF Type: complete

Annotations of Ll_transcript_302201

• Blastp: 2-hydroxyisoflavanone dehydratase from Glycyrrhiza with 55.93% of identity
• Blastx: 2-hydroxyisoflavanone dehydratase from Glycyrrhiza with 56.43% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422242.1)
• Pfam: alpha/beta hydrolase fold (PF07859.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;