Protein coding transcript 52839

• Transcript: Ll_transcript_304136
• CDS coordinates: 97-1329 (+)
• Peptide sequence: MGTRYTLAGKEVPITGSDAVRWIELSIPSSPNIAVDGAAAPLAPLTTDDRASCFVTDNPASYLLWRIHQTQPHALELLELDASKEIPKVGLRFNFPVALCPFAFICKNQITTGSSIYPYSLYVLTVTGVAYLLKIRKVSVYASSSSTILPVDELLELDLKDYIPYNVTITAIAATTGCLVIGRSDGSVFCFQLGGLDPSAPGFVHELRDEAGISRLWGLMSRGKPVGTVQDMVISDLDGKRFVFVLHLDGTLRIWDLVSYNRVFNHTMAGAMFLRLWVGQYNPDSSTFLLAILYRDTLDENLEMISLHSIQLNFGDRIVFSMEPPVKNIPLDEGRCLDAKLTMDKLWILKDDELISHTFSTNIDELEALSYALQEEFVADQLFQSSEHLADEIMRIGHSIFSSSKVSSHA*
• ORF Type: complete

Annotations of Ll_transcript_304136

• Blastp: Nuclear pore complex protein NUP160 from Arabidopsis with 38.35% of identity
• Blastx: Nuclear pore complex protein NUP160 from Arabidopsis with 37.78% of identity
• Eggnog: Nucleoporin 160kDa(ENOG410YYM5)
• Kegg: Link to kegg annotations (AT1G33410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461186.1)
• Pfam: Nucleoporin Nup120/160 (PF11715.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;