Transcript | Ll_transcript_304095 |
---|---|
CDS coordinates | 538-1236 (+) |
Peptide sequence | MADPETDEVYAKLRLVPVNRNEADCGFDGIRGINGSENKDKPVSLAKTLTQSDANNGGGFSVPRYFAETIFPRLDLSAEPPVQNILAKDVHGETWKFRHIYRGTLRRHLLTTGWTNFVNHKKLVVGDSIVFLRAENGDLWVGIRRAEKGLIGGLEISSGWNPAGGNSTVPYGGLAACLSGDDMNSLKRNGNNRNGLNLNAPSSSMMGKGNVMPEAVIEAVTLAANKQPLEVV* |
ORF Type | complete |
Blastp | Auxin response factor 16 from Arabidopsis with 61.7% of identity |
---|---|
Blastx | Auxin response factor 18 from Oryza sativa with 50.79% of identity |
Eggnog | auxin response factor(ENOG410ZZ2C) |
Kegg | Link to kegg annotations (AT4G30080) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431290.1) |
Pfam | B3 DNA binding domain (PF02362.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer