Transcript | Ll_transcript_301654 |
---|---|
CDS coordinates | 317-1081 (+) |
Peptide sequence | MHCEGCARKVRRSLKGFPGVEDVITDCKTHKVVVKGEKADPLKVQERVQRKSHRQVELLSPIPKPPTEEEKKPEEEKPKPEEKKEEPQVIIVVLNVHMHCEACSQEIKRRIEKMKGVESAEPDLKSSQVSVKGVFEPAKLVEYVHKRTGKQAVIVKQEPEKKEEAKEAATEEKKAEEGDKDKKGNGEGEENKEKKEGEEAKPVEGNAEEEINKVVDMKRNEYYYNPPRYGIEREYYHAYPGPAYPPQIFSDENPN |
ORF Type | 3prime_partial |
Blastp | Heavy metal-associated isoprenylated plant protein 7 from Arabidopsis with 57.51% of identity |
---|---|
Blastx | Heavy metal-associated isoprenylated plant protein 7 from Arabidopsis with 76.22% of identity |
Eggnog | heavy metal transport detoxification protein(COG2608) |
Kegg | Link to kegg annotations (AT5G63530) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464718.1) |
Pfam | Heavy-metal-associated domain (PF00403.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer