Protein coding transcript 5287

• Transcript: Ll_transcript_351719
• CDS coordinates: 510-812 (+)
• Peptide sequence: MLEVDNRVILPELTHVRFIISSGDVIHSYACPALGIKCDAYPGRLNQVSVLINREGLFYGQCSEICGILHSSMPIVIESVSLEKFLSLLQSQYYNNKKSN*
• ORF Type: complete

Annotations of Ll_transcript_351719

• Blastp: Cytochrome c oxidase subunit 2 from Podospora with 88.04% of identity
• Blastx: Cytochrome c oxidase subunit 2 from Neurospora with 79.28% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (PoanfMp43)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020235101.1)
• Pfam: Cytochrome C oxidase subunit II, periplasmic domain (PF00116.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;