Protein coding transcript 52904

• Transcript: Ll_transcript_302851
• CDS coordinates: 1057-1596 (+)
• Peptide sequence: MYLQEISPRYTAEAYSLLTHNCNNFSNEVSQFLVGATIPEYILSLPNEVMSSPMGALILPMIQNLETTMRSGGVPQVPQFRPSTAAPSGTASATTAKTSSSTNSSRNPDIPKTGGEPQKSSPNVVAGDPLGDARGKVQDEISKEFAAIMATGTMRASEAAALATRRVMQRYGHTAVSQS*
• ORF Type: complete

Annotations of Ll_transcript_302851

• Blastp: Desumoylating isopeptidase 1 from Homo with 50.88% of identity
• Blastx: Desumoylating isopeptidase 1 from Homo with 45.3% of identity
• Eggnog: Desumoylating isopeptidase(ENOG4111H3Z)
• Kegg: Link to kegg annotations (27351)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414038.1)
• Pfam: PPPDE putative peptidase domain (PF05903.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;