Protein coding transcript 52907

• Transcript: Ll_transcript_302854
• CDS coordinates: 172-705 (+)
• Peptide sequence: MAEEGHRVTLNVYDLSQGLARQLSTSFLGKAIEGIWHTGVAVYGNEYYFGGGIQHCPAGKTQYGVPLRVVELGVTHVPKDVFELYLQEISPRYTAEAYSLLTHNCNNFSNEVAQFLVGATIPEYILNLPNEVMSSPMGALVCKLSSTTLYFKSSDTKLFYVVLYVYVDIFSQCAIVV*
• ORF Type: complete

Annotations of Ll_transcript_302854

• Blastp: Desumoylating isopeptidase 1 from Homo with 52.52% of identity
• Blastx: Desumoylating isopeptidase 1 from Homo with 52.52% of identity
• Eggnog: Desumoylating isopeptidase(ENOG4111H3Z)
• Kegg: Link to kegg annotations (27351)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450130.1)
• Pfam: PPPDE putative peptidase domain (PF05903.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;