Protein coding transcript 52910

• Transcript: Ll_transcript_301985
• CDS coordinates: 818-1267 (+)
• Peptide sequence: MICMDRFVELSSILEPGRPPKTDKSAILIDAARMVTQLRGEAQKLKDFNTSLQEKIKELKAEKNELRDEKQSLKAEKEKLEQQVKSMNPQPGFMHHPPPGIPAAFTPQGQAPGNKLVPFMGYPGVAMWQFLPPASMDTSQDHVLRPPVA*
• ORF Type: complete

Annotations of Ll_transcript_301985

• Blastp: Transcription factor ILR3 from Arabidopsis with 76.87% of identity
• Blastx: Transcription factor ILR3 from Arabidopsis with 76.87% of identity
• Eggnog: Transcription factor(ENOG4111M4Q)
• Kegg: Link to kegg annotations (AT5G54680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437128.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;