| Transcript | Ll_transcript_301987 |
|---|---|
| CDS coordinates | 692-988 (+) |
| Peptide sequence | MVTQLRGEAQKLKDSNMGLQEKIKDLKAEKNELRDEKQRLKTEKERLEQQLMSMNAQPSFLPPPAATPAAFAAQGQAAFAAQGQAAFAAQGQAAFAAQG |
| ORF Type | 3prime_partial |
| Blastp | Transcription factor ILR3 from Arabidopsis with 79.75% of identity |
|---|---|
| Blastx | Transcription factor ILR3 from Arabidopsis with 81.03% of identity |
| Eggnog | Transcription factor(ENOG4111M4Q) |
| Kegg | Link to kegg annotations (AT5G54680) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019413832.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer