Protein coding transcript 52913

• Transcript: Ll_transcript_301988
• CDS coordinates: 216-905 (+)
• Peptide sequence: MVSPENTNWLFDYGLIDDSTFTVPSSVFTWPPNPSPNLGADLDGSLGGADGFKEPGSKKRGRSDACAGSSSKACREKLRRDRLNDKFVELSSILEPGRPPKTDKSAILIDAVRMVTQLRGEAQKLKDSNMSLQEKITELKAEKNELRDEKQRLKAEKEKLEQQVKSMNAQPGFMHHTPPVIPAAFAPQSQAPGNKLVPFMGYPGVAMWQFMPPAAVDTSQDHVLRPPVA*
• ORF Type: complete

Annotations of Ll_transcript_301988

• Blastp: Transcription factor ILR3 from Arabidopsis with 69.36% of identity
• Blastx: Transcription factor ILR3 from Arabidopsis with 69.36% of identity
• Eggnog: Transcription factor(ENOG4111M4Q)
• Kegg: Link to kegg annotations (AT5G54680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458841.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;