Transcript | Ll_transcript_301990 |
---|---|
CDS coordinates | 670-1269 (+) |
Peptide sequence | MILFDPSVELELDVSLGDSDGLKEPGSKKRGRSDSCAASSSKACREKLRRDRLNDKFVELGSILEPGRPPKTDKSAILIDAARMVTQLRGEAQKLKDFNTSLQEKIKELKAEKNELRDEKQSLKAEKEKLEQQVKSMNPQPGFMHHPPPGIPAAFTPQGQAPGNKLVPFMGYPGVAMWQFLPPASMDTSQDHVLRPPVA* |
ORF Type | complete |
Blastp | Transcription factor ILR3 from Arabidopsis with 76.32% of identity |
---|---|
Blastx | Transcription factor ILR3 from Arabidopsis with 76.32% of identity |
Eggnog | Transcription factor(ENOG4111M4Q) |
Kegg | Link to kegg annotations (AT5G54680) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437128.1) |
Pfam | Helix-loop-helix DNA-binding domain (PF00010.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer