Protein coding transcript 52918

• Transcript: Ll_transcript_301978
• CDS coordinates: 634-1101 (+)
• Peptide sequence: MFPLSISVLLAGFCVNMLLGYVPNMIDIVRFIELGSILEPGRPPKTDKTAILIDAVHMVTQLRGEAQKLKDSNMGLQEKIKDLKAEKNELRDEKQRLKTEKERLEQQLMSMNAQPSFLPPPAATPAAFAAQGQAAFAAQGQAAFAAQGQAAFAAQG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_301978

• Blastp: Transcription factor ILR3 from Arabidopsis with 78.5% of identity
• Blastx: Transcription factor ILR3 from Arabidopsis with 81.11% of identity
• Eggnog: Transcription factor(ENOG4111M4Q)
• Kegg: Link to kegg annotations (AT5G54680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413832.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;