Protein coding transcript 52965

• Transcript: Ll_transcript_303713
• CDS coordinates: 100-594 (+)
• Peptide sequence: MVCKLKKFIYGLKQASRQWNHKFHQVITSYGFEANKVDDCVYHKFSGRKFIFLVLYVNDILLASSDMRLLHETKKFLTKNFEMKDLGEASFVLGIQILRDRSQGILRLSQKSYIDKVLDRFGMKDSKPGDTPIAKRDKFSLEQCPKNDLERYEMQIFLCICTKR*
• ORF Type: complete

Annotations of Ll_transcript_303713

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 47.1% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 47.1% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015967041.1)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF07727.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;