Transcript | Ll_transcript_303114 |
---|---|
CDS coordinates | 353-1396 (+) |
Peptide sequence | MGLSSLHVCMDSSDHWLQGTIHEESGMDSSSPSGDMLTCSRPMIERRLRPPHDQALNCPRCDSTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKVSTKKSNDQLPNNNYQNQPQPQGSNSYHHNPKDLQLSFPDVQFSQLSNFLGTNAAGTLGNPDFMENRYNNINGIFNNPTRPIDFIESKVEGIIGSSSSSRNYDFFGNSDHMGMAVGLRGEYHMNGQNGLLLPSNFHSLYSPASFGAMSLDGGGNNNNRGYIMDHSCHRLMLPYDHVTNEGHNDSLDVKPNPKQLLSLEWQDQGCSDAGKDSFGYLNGPGSWNGMMNGYGSSTTNPLV* |
ORF Type | complete |
Blastp | Dof zinc finger protein DOF5.6 from Arabidopsis with 40.8% of identity |
---|---|
Blastx | Dof zinc finger protein DOF5.6 from Arabidopsis with 39% of identity |
Eggnog | Zinc finger protein(ENOG410YEQW) |
Kegg | Link to kegg annotations (AT5G62940) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414289.1) |
Pfam | Dof domain, zinc finger (PF02701.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer