Protein coding transcript 5304

• Transcript: Ll_transcript_351688
• CDS coordinates: 73-714 (+)
• Peptide sequence: MVVKVYGTAIAACPQRVLACLIEKGVEFELVHVDLDHGEQKKPEFLLLQPFGQVPVVEDGDFRLFESRAIVRYYAAKYAEHGPDLLGTTLKEKALVDQWLDVEAHNFNDSCFNIMLQLVILPKMGQVGDLGLAHSCEQKLEKVLDVYEKRLSESTYLAGEKFSLADLSHLPGIDHLIEDAKLGHLVTKRKNVNAWWEKISSRPAWKKVKNLVH*
• ORF Type: complete

Annotations of Ll_transcript_351688

• Blastp: Glutathione S-transferase F12 from Arabidopsis with 53.85% of identity
• Blastx: Glutathione S-transferase F11 from Arabidopsis with 55.45% of identity
• Eggnog: glutathione Stransferase(COG0625)
• Kegg: Link to kegg annotations (AT5G17220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439517.1)
• Pfam: Glutathione S-transferase, N-terminal domain (PF02798.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;