Protein coding transcript 5305

• Transcript: Ll_transcript_351689
• CDS coordinates: 130-648 (+)
• Peptide sequence: MSVRFLMQPFGQVPVVEDGDFRLFESRAIVRYYAAKYAEHGPDLLGTTLKEKALVDQWLDVEAHNFNDSCFNIMLQLVILPKMGQVGDLGLAHSCEQKLEKVLDVYEKRLSESTYLAGEKFSLADLSHLPGIDHLIEDAKLGHLVTKRKNVNAWWEKISSRPAWKKVKNLVH*
• ORF Type: complete

Annotations of Ll_transcript_351689

• Blastp: Glutathione S-transferase F11 from Arabidopsis with 51.81% of identity
• Blastx: Glutathione S-transferase F11 from Arabidopsis with 51.81% of identity
• Eggnog: glutathione Stransferase(COG0625)
• Kegg: Link to kegg annotations (AT3G03190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439517.1)
• Pfam: Glutathione S-transferase, N-terminal domain (PF02798.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;