Protein coding transcript 53087

• Transcript: Ll_transcript_304146
• CDS coordinates: 201-713 (+)
• Peptide sequence: MPSSPKSSTHYARQAATSRRSTVFIAVIIITIIGIVALLRTSVGSRCLSPHPRSVRVVWEHGRSDGNLGVETKRHKVMGFVGIQTGFESVGRRKALRKTWFPSDHEGLQRLEEATGLAFRFIIGKTSDKAKMSALKKEISEYDDFLQLDIEEEYSKLPYKTCVLRSTKLL*
• ORF Type: complete

Annotations of Ll_transcript_304146

• Blastp: Probable beta-1,3-galactosyltransferase 14 from Arabidopsis with 55.03% of identity
• Blastx: Probable beta-1,3-galactosyltransferase 14 from Arabidopsis with 62.43% of identity
• Eggnog: Beta-1,3-galactosyltransferase(ENOG410XV5H)
• Kegg: Link to kegg annotations (AT1G53290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464903.1)
• Pfam: Galactosyltransferase (PF01762.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;