Protein coding transcript 53225

• Transcript: Ll_transcript_302121
• CDS coordinates: 89-601 (+)
• Peptide sequence: MDSPSNPYLPLLQALFQIPFHHYLIAISFALIVYLYDFIESHFLQDLFSGFTGSPVELTYNSCSQLYQAVVSKCKILHGSYLATPWLSSPHIQTCFLNFFGNPPVFNYKRQLFTTPDGGTLALDWLMSSDVSGGASHTDSVVSEDESTPIVVVIPGLTSDSSSAQSVDGT*
• ORF Type: complete

Annotations of Ll_transcript_302121

• Blastp: Embryogenesis-associated protein EMB8 from Picea with 28% of identity
• Blastx: Embryogenesis-associated protein EMB8 from Picea with 33.94% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453648.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;