| Transcript | Ll_transcript_302137 |
|---|---|
| CDS coordinates | 1878-2231 (+) |
| Peptide sequence | MASYENQGKPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTAAGGSGRITSQRKYDTHKDDDKSSSKVHNLISTIKYKQNQRSCSNIMIIITNGIIYIYIYFGCRKNGFALNLLKQG* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | RPM1-interacting protein 4 from Arabidopsis with 56.76% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | Link to cantataDB annotations (CNT0000616) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019463834.1) |
| Pfam | CAAX protease self-immunity (PF02517.15) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer