Protein coding transcript 53292

• Transcript: Ll_transcript_302009
• CDS coordinates: 153-830 (+)
• Peptide sequence: MINNSSLCSALTSIRYALGQGATAIAVDIEDVHPVTSGETISMKISQHGVQRRKVAGLTEGEPTGDTYNLFAFPSECNFSGLRFGLDLVNIMKESSRRISGISSVCNNGQWMVLIDAAKGCATMPPDLSKYPADFVTISFYKLFGYPTGLGALIVRNDAAKLLKKTYFSGGLLPSLLLACFLFIHSYMVGWSQSQARLMHQLLILTSLKGGSTLNICLRMALLRS*
• ORF Type: complete

Annotations of Ll_transcript_302009

• Blastp: Molybdenum cofactor sulfurase from Arabidopsis with 63.41% of identity
• Blastx: Molybdenum cofactor sulfurase from Arabidopsis with 62.42% of identity
• Eggnog: cysteine desulfurase(COG0520)
• Kegg: Link to kegg annotations (AT1G16540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413649.1)
• Pfam: Aminotransferase class-V (PF00266.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;