Transcript | Ll_transcript_302032 |
---|---|
CDS coordinates | 485-793 (+) |
Peptide sequence | MPPDLSKYPADFVTISFYKLFGYPTGLGALIVRNDAAKLLKKTYFSGGLLPSLLLACFLFIHSYMVGWSQSQARLMHQLLILTSLKGGSTLNICLRMALLRS* |
ORF Type | complete |
Blastp | Molybdenum cofactor sulfurase from Lycopersicon with 55.29% of identity |
---|---|
Blastx | Molybdenum cofactor sulfurase from Lycopersicon with 56.31% of identity |
Eggnog | cysteine desulfurase(COG0520) |
Kegg | Link to kegg annotations (543832) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413649.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer