Transcript | Ll_transcript_302046 |
---|---|
CDS coordinates | 153-830 (+) |
Peptide sequence | MINNSSLCSALTSIRYALGQGATAIAVDIEDVHPVTSGETISMKISQHGVQRRKVAGLTEGEPTGDTYNLFAFPSECNFSGLRFGLDLVNIMKESSRRISGISSVCNNGQWMVLIDAAKGCATMPPDLSKYPADFVTISFYKLFGYPTGLGALIVRNDAAKLLKKTYFSGGLLPSLLLACFLFIHSYMVGWSQSQARLMHQLLILTSLKGGSTLNICLRMALLRS* |
ORF Type | complete |
Blastp | Molybdenum cofactor sulfurase from Arabidopsis with 63.41% of identity |
---|---|
Blastx | Molybdenum cofactor sulfurase from Arabidopsis with 60.87% of identity |
Eggnog | cysteine desulfurase(COG0520) |
Kegg | Link to kegg annotations (AT1G16540) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413650.1) |
Pfam | Aminotransferase class-V (PF00266.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer