Protein coding transcript 53382

• Transcript: Ll_transcript_304283
• CDS coordinates: 346-690 (+)
• Peptide sequence: MEAMSIERKRTLVEKVRKDSMVEKEVENEVEEEYENGGVGLTEEVRKKGIDGSKGSSSGGGGVSPPSCQAERCGADLTDAKKYHRRHKVCEFHSKAPVVVVAGLRQRFCQQCSRF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_304283

• Blastp: Squamosa promoter-binding-like protein 8 from Arabidopsis with 70.49% of identity
• Blastx: Squamosa promoter-binding protein 1 from Antirrhinum with 75% of identity
• Eggnog: Squamosa promoter-binding-like protein(ENOG41120IC)
• Kegg: Link to kegg annotations (AT1G02065)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450579.1)
• Pfam: SBP domain (PF03110.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;