Protein coding transcript 53384

• Transcript: Ll_transcript_304273
• CDS coordinates: 1-312 (+)
• Peptide sequence: PKVVIAGSERRFCQQCSRFHGLSEFDDKKRSCRQRLLDHNARRRKAHPDAVRLNTSALSSSPYGIEDPITSSNMNATQDVNYALSLLSNNSSWNTAYETNSFSI
• ORF Type: internal

Annotations of Ll_transcript_304273

• Blastp: Squamosa promoter-binding-like protein 2 from Arabidopsis with 40.4% of identity
• Blastx: Squamosa promoter-binding-like protein 3 from Oryza sativa with 71.43% of identity
• Eggnog: Squamosa promoter-binding-like protein(ENOG410YKP9)
• Kegg: Link to kegg annotations (AT5G43270)
• CantataDB: Link to cantataDB annotations (CNT0002898)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438295.1)
• Pfam: SBP domain (PF03110.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;