Protein coding transcript 53432

• Transcript: Ll_transcript_303090
• CDS coordinates: 410-811 (+)
• Peptide sequence: MAKFVCSRGLTKEPVDLRISKTIALWSSNQNLILSFSLNTLMLTTSSLYSMVEPIVTPDKRQAYNLQCGDALRLPAGTTSYILNPDDNQNLRIVKLAIPINNPSNFYDFYPSSTKDQQSYFSGFSRNTLEATFN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_303090

• Blastp: Conglutin beta 7 from Lupinus with 92.5% of identity
• Blastx: Conglutin beta 7 from Lupinus with 92.5% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439203.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;