Protein coding transcript 53525

• Transcript: Ll_transcript_303867
• CDS coordinates: 1-462 (+)
• Peptide sequence: RTYSIWFVLFSWIICYFYFFFSLQREKVEQLILEPTVNHAIVCDDLKKVYPGRDGNPEKIAVSGLSLALPQGECVGMLGPNGAGKTSFIHMMIGLTKPTSGTAFVHGLDIRTHMDGIYTSMGVCPQHDLLWETLTGREHLLFYGRLKNLKGSAL
• ORF Type: internal

Annotations of Ll_transcript_303867

• Blastp: ABC transporter A family member 5 from Arabidopsis with 80.15% of identity
• Blastx: ABC transporter A family member 5 from Arabidopsis with 80.15% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G47760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429341.1)
• Pfam: ABC transporter (PF00005.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;