Protein coding transcript 53531

• Transcript: Ll_transcript_303840
• CDS coordinates: 1-417 (+)
• Peptide sequence: RTYSIWFVLFSWIICYFYFFFSLQREKVEQLILEPTVNHAIVCDDLKKVYPGRDGNPEKIAVSGLSLALPQGECVGMLGPNGAGKTSFIHMMIGLTKPTSGTAFVHGLDIRTHMDGIYTSMGVCPQHEKRAPTLLWQT*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_303840

• Blastp: ABC transporter A family member 5 from Arabidopsis with 72.17% of identity
• Blastx: ABC transporter A family member 5 from Arabidopsis with 72.17% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G47760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429341.1)
• Pfam: ABC transporter (PF00005.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;