Protein coding transcript 53605

• Transcript: Ll_transcript_302644
• CDS coordinates: 376-912 (+)
• Peptide sequence: MAIDTIEASSPPFHTGQSGQSRHFYLAVDRLQFKMQTMVDLLDLVGRRQYFPIVVCCSTRDDLDSLCNSLSPLPFISYSALYSDLAEDERAFILDKFRQVTTRWNQTNHTGAGNEDEVGKDDDRSHVIIVTDTCLPLLASGEPPMNGHLLINYDLPAKKETYGRRMATCLTAGPVFDT*
• ORF Type: complete

Annotations of Ll_transcript_302644

• Blastp: ATP-dependent RNA helicase eIF4A from Cryptococcus neoformans species complex with 32.62% of identity
• Blastx: Eukaryotic initiation factor 4A from Cryptosporidium with 28.77% of identity
• Eggnog: purine NTP-dependent helicase activity(COG0513)
• Kegg: Link to kegg annotations (CNA07620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420249.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;