Protein coding transcript 53607

• Transcript: Ll_transcript_302646
• CDS coordinates: 290-922 (+)
• Peptide sequence: MAIDTIEASSPPFHTGQSGQSRHFYLAVDRLQFKMQTMVDLLDLVGRRQYFPIVVCCSTRDDLDSLCNSLSPLPFISYSALYSDLAEDERAFILDKFRQVTTRWNQTNHTGAGNEDEVGKDDDRSHVIIVTDTCLPLLASGEPPMNGHLLINYDLPAKKETYGRRMATCLTADGIVINMVVGGEVVTLKSIEESSGIIMQEMPMRILDIL*
• ORF Type: complete

Annotations of Ll_transcript_302646

• Blastp: Eukaryotic initiation factor 4A from Cryptosporidium with 30.37% of identity
• Blastx: Eukaryotic initiation factor 4A from Cryptosporidium with 30.37% of identity
• Eggnog: purine NTP-dependent helicase activity(COG0513)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420249.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;