Transcript | Ll_transcript_302648 |
---|---|
CDS coordinates | 376-1083 (+) |
Peptide sequence | MAIDTIEASSPPFHTGQSGQSRHFYLAVDRLQFKMQTMVDLLDLVGRRQYFPIVVCCSTRDDLDSLCNSLSPLPFISYSALYSDLAEDERAFILDKFRQVTTRWNQTNHTGAGNEDEVGKDDDRSHVIIVTDTCLPLLASGEPPMNGHLLINYDLPAKKVLFPYTCYLPCLLVFMCAIPIPTILVQKSVVLHSVFSNLFFLLVKLVSSNYFSVVICGVSFAFLTCYCLSGRSCGN* |
ORF Type | complete |
Blastp | ATP-dependent RNA helicase eIF4A from Cryptococcus neoformans species complex with 31.88% of identity |
---|---|
Blastx | ATP-dependent RNA helicase eIF4A from Cryptococcus neoformans species complex with 31.88% of identity |
Eggnog | purine NTP-dependent helicase activity(COG0513) |
Kegg | Link to kegg annotations (CNA07620) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420249.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer