Protein coding transcript 53613

• Transcript: Ll_transcript_302653
• CDS coordinates: 786-1964 (+)
• Peptide sequence: MHVHYFFCSITIHFLSIVNVLLSSKDCQYGSLNATMAAGKIVLCFSLSDQQDIISASLTVKEAGGVGLIYAQFHEDGLNQCGVFPCIKVDYEVGTQILSYIRRTRFPTASLSLPRTVIGKLTSPQVSSFSSRGPSSMSPTVLKPDIAAPGVDILAAFPPQGTTQNSGFALLSGTSMSCPHVAGIAALIKSKHPTWSPAAIRSALVTTASQTGTDGSVISEEGSTYKTADPFDLGGGHVNPNKAMDPGLIYNITTEDYIHFLCSIGYGSASISKMTKTTTKCKKEKHQELNLNLPSISIPYLKKGAKVVRTVTNVGNITSVYKAQVKAPYGIKVRVEPQILSFNSSSTVLSFNISFLSTLKLHGDYRFGSLTWTNGKQFVRIPIAVRTIQFEC*
• ORF Type: complete

Annotations of Ll_transcript_302653

• Blastp: Subtilisin-like protease SBT3.3 from Arabidopsis with 52.1% of identity
• Blastx: Subtilisin-like protease SBT3.17 from Arabidopsis with 45.14% of identity
• Eggnog: peptidase (S8 and S53, subtilisin, kexin, sedolisin(COG1404)
• Kegg: Link to kegg annotations (AT1G32960)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464295.1)
• Pfam: Subtilase family (PF00082.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;