Protein coding transcript 53614

• Transcript: Ll_transcript_302654
• CDS coordinates: 549-998 (+)
• Peptide sequence: MDPGLIYNITTEDYIHFLCSIGYGSASISKMTKTTTKCKKEKHQELNLNLPSISIPYLKKGAKVVRTVTNVGNITSVYKAQVKAPYGIKVRVEPQILSFNSSSTVLSFNISFLSTLKLHGDYRFGSLTWTNGKQFVRIPIAVRTIQFEC*
• ORF Type: complete

Annotations of Ll_transcript_302654

• Blastp: Subtilisin-like protease SBT3.11 from Arabidopsis with 48.97% of identity
• Blastx: Subtilisin-like protease SBT3.16 from Arabidopsis with 45.6% of identity
• Eggnog: peptidase (S8 and S53, subtilisin, kexin, sedolisin(COG1404)
• Kegg: Link to kegg annotations (AT5G11940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464296.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;